PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_6DL_29EF04226.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family MYB
Protein Properties Length: 470aa    MW: 49822 Da    PI: 8.3115
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_6DL_29EF04226.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding475.8e-15119167148
                            TSSS-HHHHHHHHHHHHHTTTT.-HHHHHHHHTTTS-HHHHHHHHHHHT CS
        Myb_DNA-binding   1 rgrWTteEdellvdavkqlGgg.tWktIartmgkgRtlkqcksrwqkyl 48 
                            +g+W++eEd +l+ ++ + G+g +W + ++++g++R++k+c++rw++yl
  Traes_6DL_29EF04226.1 119 KGPWSPEEDAKLKAYIDENGTGgNWIALPQKIGLKRCGKSCRLRWLNYL 167
                            79*********************************************97 PP

2Myb_DNA-binding38.42.9e-12174216246
                            SSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
        Myb_DNA-binding   2 grWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                            g +T+eE+ ++  +    G++ W+ Ia+ ++ gRt++++k++w++
  Traes_6DL_29EF04226.1 174 GDFTEEEEHIICSLYISIGSR-WSIIAAQLP-GRTDNDIKNYWNT 216
                            789******************.*********.***********97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.946114167IPR017930Myb domain
SuperFamilySSF466893.3E-25117214IPR009057Homeodomain-like
SMARTSM007172.5E-11118169IPR001005SANT/Myb domain
PfamPF002494.2E-14119167IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.0E-23120174IPR009057Homeodomain-like
CDDcd001673.56E-8121167No hitNo description
PROSITE profilePS5129421.924168222IPR017930Myb domain
SMARTSM007172.9E-10172220IPR001005SANT/Myb domain
PfamPF002496.3E-11174216IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.5E-22175222IPR009057Homeodomain-like
CDDcd001678.98E-7176216No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 470 aa     Download sequence    Send to blast
RCPRDPGYKA PHITFLVSSQ THTPVTTPSP VVQHTSSRPS PTQLPTSIAA ASTARSSSVF  60
FDRADQLISD LFSGRLAVAV ASGGGRRGGE EVDRLRRPIP PHRAAMGRAP CCDKATVKKG  120
PWSPEEDAKL KAYIDENGTG GNWIALPQKI GLKRCGKSCR LRWLNYLRPN IKHGDFTEEE  180
EHIICSLYIS IGSRWSIIAA QLPGRTDNDI KNYWNTKLKK KLLGKRAPSR RLQRASQDAP  240
MPYSYLAAGG GGASSSGNAN GTTAALSSSA LERIQLHMRL QGLYSAFGCG ASNAPPQWPK  300
LEPPTDAVAM TTVSHGHSLA AADVVEAEQQ LNPSAGASYD MPVPGGFEER SASKLGFGSA  360
AGEAAGVAST VEMSSGSMVG GGFGYGHVDE LYDFLYSKQL AAAGAFQGGV PPLPELQCPD  420
GGAVVGADEK FSTWMASCDH YVPTTGGQQL QLQAGGNSMN LQDFVLGYDQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1a5j_A5e-251192227108B-MYB
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015689197.11e-137PREDICTED: transcription factor MYB36-like
TrEMBLW5GV070.0W5GV07_WHEAT; Uncharacterized protein
STRINGMLOC_58499.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP13538412
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57620.11e-87myb domain protein 36
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]